PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011077211.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family G2-like
Protein Properties Length: 391aa    MW: 42563 Da    PI: 8.9106
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011077211.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32224279156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_011077211.1 224 KARRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 279
                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-28221282IPR009057Homeodomain-like
PROSITE profilePS5129414.468221281IPR017930Myb domain
SuperFamilySSF466891.55E-18222282IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-27224279IPR006447Myb domain, plants
PfamPF002497.8E-8226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MMINTHNNSD ISEKMQRCQD YIHALEEERR KIQVFQRELP LCLELVTQAI ETCKQQLSGT  60
TTECNLHGQS ECSEQTSTPV FEEFIPIKRA SSHSDGEEQE SKKPKNESNA GNKDGKNGND  120
KNSKKSDWLR SVQLWNQTPD PPSKEDSPRK VAVVEVKRNG GSGAFHPFKK EKSTAGDDGT  180
ATPPPQGSMN RPLPPASTSS TAETGGGSGG GNKKEGKEGQ SQRKARRCWS PELHRRFLQA  240
LQQLGGSHVA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPNPSIHNN NNNNAQTPQF  300
VVVGGIWVPP EYAAMATTTT SGEAAGAAAS KGIYTPIAAP PPPFQESPAS SKQRQHKTCS  360
HSDDRGSNST EGGVQSCTRS TSSSSTHTAT A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077211.10.0PREDICTED: uncharacterized protein LOC105161268
TrEMBLA0A068TX101e-160A0A068TX10_COFCA; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-94G2-like family protein